ELISA Recombinant Vibrio splendidus UPF0397 protein VS_II0189 (VS_II0189)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Vibrio splendidus (strain LGP32) (Vibrio splendidus (strain Mel32)) Uniprot NO.:B7VQF8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNFSAKTVVVIAIGAALYGIGGLPMFGVPVFANTTLKPAMAVLALFSVLFGPIVGFLVGF IGHWVTDLFAGWGVWLTWVLGSGIVGMVIGLFPMMTKNRLQQGELPMKDFALFVVLALAG NVVGYGSSAFLDTILYAEPFTKVFTQLSIIAAGNTILIAVVGFLILKSVAKRNKQSRNLT EA Protein Names:Recommended name: UPF0397 protein VS_II0189 Gene Names:Ordered Locus Names:VS_II0189 Expression Region:1-182 Sequence Info:fµLl length protein