ELISA Recombinant Talaromyces stipitatus High osmolarity signaling protein sho1(sho1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) (Penicillium stipitatum) Uniprot NO.:B8MD74 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPRFDPSNILGDPFALSTISISIIAWIISFIGSIIADVQTDFPNYAWWAVAYMICVIAGI IVVVGSDTTLIYSNAVVGYLSAGLAFTTLAVNSLVYQPQSSKQAAAAGFILLSMINIIWI FYFGSTPESSHRQAIDSLALNKVGNAYHNSRPASNAFGARPATTVSQPPQMYTSAQLNGF ETSSPMSGYPGGPPGSDKRNTTATNFPPANVEPSNEVSQPTEYPYKAKAIYSYDANPDDA NEISFTKGEELEVSDVSGRWWQARRANGETGIAPSNYLILL Protein Names:Recommended name: High osmolarity signaling protein sho1 Alternative name(s): Osmosensor sho1 Gene Names:Name:sho1 ORF Names:TSTA_114130 Expression Region:1-281 Sequence Info:fµLl length protein