ELISA Recombinant Talaromyces stipitatus Altered inheritance of mitochondria protein 31, mitochondrial(aim31)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) (Penicillium stipitatum)
Uniprot NO.:B8MJJ2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MADQADLLESPQFEEETSMQKFKRRLKEEPLIPLGCAATCYALYRAYRSGKAKDSVEMNR MFRARIYAQFFTLLAVVAGGMYYKTERKQRREFERKVEERKAQEKRDAWLRELEAREKED KGWRERHAAVSEAANNPVGVSAVVAGKKEEEEKGVDGNVNQAPQEEGGVKRGTGILDAVK ALVRGKKD
Protein Names:Recommended name: Altered inheritance of mitochondria protein 31, mitochondrial
Gene Names:Name:aim31 ORF Names:TSTA_046460
Expression Region:1-188
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.