Skip to Content

ELISA Recombinant Talaromyces stipitatus Putative dipeptidase TSTA_079200 (TSTA_079200)

https://www.anagnostics.com/web/image/product.template/159740/image_1920?unique=b3f4f0f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) (Penicillium stipitatum) Uniprot NO.:B8LWT1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MATLNTRGNDIALNILSSTTESSQAVVLSRARGSPNSQRAWLFGLGTLGIILASVLLNPF TSTQESPLNIDPTDYAARTKHILSTTPLIDGHNDLPYLIRTELKHQIYNDRFTFNTGLLS NTDRKKLRDGMVGGQFWSAYIHCPKDSETNKDVPLDEATWTLRDTLEQIDITKRFVDEFP DLFQFCSNSSCAREAFANGKIGSFIGIEGAHQIGNSLASLRQLYDLGARYITTTHNCDNV FGTAASTVSAGGEDKGLTLFGEEYVAEMNRLGMmLDLSHVSHETMRDTLRLSEAPVIFSH TGAYALSKTLRFAPDDVLKATAEKGGIIMITFINRFLRPDDPDAATIHDVVDHIWHVAQV AGWDHVGVGSDFDGTPVTPRGLEDVSKYPRLVELLMERGATDDQIRKFAGDNILRVWSEV EKAAERIQVEGRKPNEAIWEGRTWVRSEMSPPIMFRDSIGRRIPSYLGEP Protein Names:Recommended name: Putative dipeptidase TSTA_079200 EC= 3.4.13.19 Gene Names:ORF Names:TSTA_079200 Expression Region:1-470 Sequence Info:fµLl length protein

1,831.00 € 1831.0 EUR 1,831.00 €

1,831.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.