ELISA Recombinant Streptococcus uberis UPF0397 protein SUB0313 (SUB0313)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Streptococcus uberis (strain ATCC BAA-854 / 0140J) Uniprot NO.:B9DTI6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKNTSIKTVVAIGIGAALFVIIGLFVPITIFTNTTISLQYAVQALFSVLFGPVAGFFIGF IGHmLKDMFAGYGVWWSWVLPSGLVGLGIGSLKNRLKVDKGIFSKKDILSFNLVQALVNL ISWAIVAPLGDILIYQEPANKVFTQGLFAAFANTFTIGIGGTLLLIAYANSRPKAGSLRK D Protein Names:Recommended name: UPF0397 protein SUB0313 Gene Names:Ordered Locus Names:SUB0313 Expression Region:1-181 Sequence Info:fµLl length protein