ELISA Recombinant Streptococcus pneumoniae UPF0397 protein SPN23F04390 (SPN23F04390)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
Uniprot NO.:B8ZLW2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEIKFTIKQVVAVGIGAALFVVIGMINIPTPVPNTSIQLQYAVQALLSIIFGPIIGLLVG LIGHAIKDSLAGYGLWWTWIIASGLFGLVVGLFRKYVRVINGVFDWKDILIFNLIQLLAN ALVWGVLAPLGDVVIYQEAAEKVFAQGIVAGIANGVSVAIAGTLLLLAYAGTQTRAGSLK KD
Protein Names:Recommended name: UPF0397 protein SPN23F04390
Gene Names:Ordered Locus Names:SPN23F04390
Expression Region:1-182
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.