ELISA Recombinant Streptococcus equi subsp. equi Energy-coupling factor transporter transmembrane protein EcfT(ecfT)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Streptococcus equi subsp. equi (strain 4047) Uniprot NO.:C0MBF3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDKLILGRYIPGNSIIHRLDPRSKLLAMIIYIIIIFWANNVVTNLLLLAFTLLLIFLSQI KWSFFFNGVKPMIGIILFTTLFQVFFTQGGSVLFQLGIIKITSLGLSQAILIFMRFVLII FFSTLLTLTTTPLSLSDAVEALLKPLVRFKVPAHEIGLmLSLSLRFVPTLMDDTTRIMNA QKARGVDFGEGNLIQKVKSIIPILIPLFASSFKRADALAIAMEARGYQGGDSRTKYRLLS WQLKDTLAIILVVILGIFLFCLKSPSRLT Protein Names:Recommended name: Energy-coupling factor transporter transmembrane protein EcfT Short name= ECF transporter T component EcfT Gene Names:Name:ecfT Ordered Locus Names:SEQ_2213 Expression Region:1-269 Sequence Info:fµLl length protein