ELISA Recombinant Populus trichocarpa Casparian strip membrane protein POPTRDRAFT_763057 (POPTRDRAFT_763057)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:PopµLus trichocarpa (Western balsam poplar) (PopµLus balsamifera subsp. trichocarpa) Uniprot NO.:B9HBX2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKSESAAIDIPESSSVAKGKAPLIAVSRNEKGGYRKGIAIFDFILRLAAIATALAAAAAM GTSDETLPFFTQFFQFQASYDDLPTFQFFVIAIAIVGGYLVLSLPFSIVAIVRPHAVGPR LLLIILDAVALTLNTAAGAAAAAIVYLAHNGNSNTNWLAICQQYGDFCQKVSGAVVASFI TVVIFVFLIVLSAFALRRH Protein Names:Recommended name: Casparian strip membrane protein POPTRDRAFT_763057 Gene Names:ORF Names:POPTRDRAFT_763057 Expression Region:1-199 Sequence Info:fµLl length protein