Skip to Content

ELISA Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_834139 (POPTRDRAFT_834139)

https://www.anagnostics.com/web/image/product.template/150292/image_1920?unique=41ec440
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:PopµLus trichocarpa (Western balsam poplar) (PopµLus balsamifera subsp. trichocarpa) Uniprot NO.:B9I0G0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEKRDKGSSPMATMMGSRDENEDVENTTRTAETmLRLVPMALCVSALVVmLKNTQTNDYG SLSYSDLGAFRYLVHVNGICAGYSLLSAVIVAMPRASTMPRAWAFFLLDQVLTYVILAAG TVSTEVLYLASKGDTTITWSEACVSFGGFCHKALISIVITFVVVICYAALSLLSSYKLFS KYDSPVLTYPGKGIEIATFHG Protein Names:Recommended name: CASP-like protein POPTRDRAFT_834139 Gene Names:ORF Names:POPTRDRAFT_834139 Expression Region:1-201 Sequence Info:fµLl length protein

1,547.00 € 1547.0 EUR 1,547.00 €

1,547.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.