ELISA Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_824792 (POPTRDRAFT_824792)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:PopµLus trichocarpa (Western balsam poplar) (PopµLus balsamifera subsp. trichocarpa) Uniprot NO.:B9IFI5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPNNEAKFSVNQPLKTQKLFIGVQIFFRIVAIAASVASSWLMITSKQVIDIGGIVLDARY SYSPEFKFLAFTNIVVGCFSLLSLLFLVLVVRQGSNPNHYFFLFLHDLAMMSLVVGGCAA ATTVGFLGKHGNSHTGWMQICDNFGKFCNRAQTSVTISYLNLICLSILTITSASKSRKME A Protein Names:Recommended name: CASP-like protein POPTRDRAFT_824792 Gene Names:ORF Names:POPTRDRAFT_824792 Expression Region:1-181 Sequence Info:fµLl length protein