ELISA Recombinant Rhodobacter sphaeroides UPF0060 membrane protein RSKD131_0092 (RSKD131_0092)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rhodobacter sphaeroides (strain KD131 / KCTC 12085) Uniprot NO.:B9KLG9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGLSLAAYAGAALAEIAGCFAVWAWWRLGASALWLVPGALSLGAFAWLLALTPVEVAGRS YAVYGGIYVAASLLWLWAVEGVRPDRWDMGGAALVLAGAAVILWAPRG Protein Names:Recommended name: UPF0060 membrane protein RSKD131_0092 Gene Names:Ordered Locus Names:RSKD131_0092 Expression Region:1-108 Sequence Info:fµLl length protein