ELISA Recombinant Ricinus communis Casparian strip membrane protein RCOM_1259250 (RCOM_1259250)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Ricinus communis (Castor bean) Uniprot NO.:B9SX12 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSTTIEIPAESSAVAKGKAPLIGASSSSYEKKGGYKKGIAIFDFILRLGAVISALSAAAT MGTSDETLPFFTQFFQFEAGYDDFPTFQFFVIAMGFVGGYLVLSLPFSVVAIIRPHAVGI RLLLLILDTVALTLNTAAAAAAAAIVYLAHNGNQSANWLAVCQQFGDFCQKVSGGVVASF VSVLVFLLLVVMSAVALRKH Protein Names:Recommended name: Casparian strip membrane protein RCOM_1259250 Gene Names:ORF Names:RCOM_1259250 Expression Region:1-200 Sequence Info:fµLl length protein