ELISA Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_873343 (POPTRDRAFT_873343)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:PopµLus trichocarpa (Western balsam poplar) (PopµLus balsamifera subsp. trichocarpa)
Uniprot NO.:B9HI87
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKAEAVESGEASTIIAAPKRGINRGISIADLILRGVAAIGTFASALTMGTTSETLTIFTQ PIMIRAKYNDLPSLTFFVIANSIVCGYLVLSIPLSISHFIRREARITRIILVIFDTAMVE LLTAGAAAATVVVYLAHKGNANWLAICQQFNNFCERISGSLIGSFASIIMImLIIITSAV ALSRH
Protein Names:Recommended name: CASP-like protein POPTRDRAFT_873343
Gene Names:ORF Names:POPTRDRAFT_873343
Expression Region:1-185
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.