ELISA Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_670582 (POPTRDRAFT_670582)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:PopµLus trichocarpa (Western balsam poplar) (PopµLus balsamifera subsp. trichocarpa) Uniprot NO.:B9N2D0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MMKPKRLLSLLLRLIAVGATLAAVIIMATSHEKGTFFAVSYEAKYTDTPAFKYFVIANAI VTVYGFLVLFHPPGSPLWRLVLALDLVFTmLLISSISAALAVAQVGKNGNSRAGWLPVCG QVTKYCNQVTGALVAGLIALITYIILLLHSIYTFLNPLLEKA Protein Names:Recommended name: CASP-like protein POPTRDRAFT_670582 Gene Names:ORF Names:POPTRDRAFT_670582 Expression Region:1-162 Sequence Info:fµLl length protein