ELISA Recombinant Ricinus communis CASP-like protein RCOM_1174750 (RCOM_1174750)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Ricinus communis (Castor bean) Uniprot NO.:B9RW00 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAKAKRVFTLLLRLIAFGTALVAAIVMATSHESGSFFTVSYEAKYSDTPAFKYFVIVNAI VTVYSFLALFLPSESLLWRLVIVTDVVFTmLVTSSISAAVAVAQVGKKGNSHAGWLPICG QVPKFCDQVTGALAAAFISLITYAILLLYSIHTVLNPLLLQKT Protein Names:Recommended name: CASP-like protein RCOM_1174750 Gene Names:ORF Names:RCOM_1174750 Expression Region:1-163 Sequence Info:fµLl length protein