ELISA Recombinant Salmonella paratyphi C Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF(arnF)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Salmonella paratyphi C (strain RKS4594)
Uniprot NO.:C0Q065
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGVMWGLISVAIASLAQLSLGFAMMRLPSIAHPLAFISGLGAFNAATLALFAGLAGYLVS VFCWQKTLHTLALSKAYALLSLSYVLVWVASmLLPGLQGAFSLKAmLGVLCIMAGVmLIF LPARS
Protein Names:Recommended name: Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF Short name= L-Ara4N-phosphoundecaprenol flippase subunit ArnF Alternative name(s): Undecaprenyl phosphate-aminoarabinose flippase subunit ArnF
Gene Names:Name:arnF Ordered Locus Names:SPC_1408
Expression Region:1-125
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.