ELISA Recombinant Rhizobium sp. UPF0314 protein NGR_c32320 (NGR_c32320)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rhizobium sp. (strain NGR234) Uniprot NO.:C3MAH2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTIAAGTDDNRQRSTWIWLIACLGVVAIQILTQHLMGRLWICECGYVKLWEGVVNSSGNS QHISDWYTPSHIIHGFLFYGLGYLLLRGKPLSVRLLLATLIESAWEIAENTPMVINRYRS ATISLDYFGDSILNSTMDTLAMAAGFLLASRLPVAVTVTIAIVLELFTGWIIRDNLTLNV LmLVWPLDAVKAWQAGL Protein Names:Recommended name: UPF0314 protein NGR_c32320 Gene Names:Ordered Locus Names:NGR_c32320 Expression Region:1-197 Sequence Info:fµLl length protein