Skip to Content

ELISA Recombinant Rhizobium sp. NADH-quinone oxidoreductase subunit K 2(nuoK2)

https://www.anagnostics.com/web/image/product.template/153570/image_1920?unique=e16ca1f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rhizobium sp. (strain NGR234) Uniprot NO.:C3MEY7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVPLWWHISLGVALFVIGAAGVLLRRNILVVLMSLELLLNSVNINFIAFGRYYADFRGQI FAIFVIAITAAEVAVALGILVALVRNKSTLKVDDVTVMKG Protein Names:Recommended name: NADH-quinone oxidoreductase subunit K 2 EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit K 2 NDH-1 subunit K 2 Gene Names:Name:nuoK2 Ordered Locus Names:NGR_c22180 Expression Region:1-100 Sequence Info:fµLl length protein

1,441.00 € 1441.0 EUR 1,441.00 €

1,441.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.