ELISA Recombinant Sulfolobus islandicus Cobalamin synthase(cobS)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:SµLfolobus islandicus (strain M.16.27) Uniprot NO.:C3N0R7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRLKGVLALFSFFTAIPIKSNASLEEIAEYSYISPLIIGISLALIESAVYVLLYRILEAL AGIVLLGVVELLRGFNHLDGLLDLGDALMIKGDRERKIKALKDVEIGSGGIGLLLVYLSI QIVALLKLGFSFYTIFYLISSNVLSMTIGLYILSTISPIPESNLGKIFHNKLKGKSTVLL FELIPFISLYNIIVFLVFYMIMHKICRSLGGSSGDIAGASITLSFPLFLLTNEITNLNYS LLSILCYLFLYLH Protein Names:Recommended name: Cobalamin synthase EC= 2.-.-.- Gene Names:Name:cobS Ordered Locus Names:M1627_2212 Expression Region:1-253 Sequence Info:fµLl length protein