ELISA Recombinant Sulfolobus islandicus Cobalamin synthase(cobS)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:SµLfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) Uniprot NO.:C3N903 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRLKGVLALFSFFTAIPIKSNASLEEIAEYSYISPLIIGISLALIESAVYVLLYRILEAL AGIVLLGVVELLRGFNHLDGLLDLGDALMIKGDRERKIKALKDVEIGSGGIGLLLVYLSI QIVALLKLGFSFYTIFHLISSNVLSMTIGLYILSTISPIPESNLGKIFHNKLKGKSTVLL LELIPFISLYNIIVFLVFYMIMHKICRSLGGSSGDIAGASITLSFPLFLLTNEITNLNYS LLSILCYLFLHLH Protein Names:Recommended name: Cobalamin synthase EC= 2.-.-.- Gene Names:Name:cobS Ordered Locus Names:YG5714_2259 Expression Region:1-253 Sequence Info:fµLl length protein