ELISA Recombinant Uncinocarpus reesii Protein GET1(GET1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Uncinocarpus reesii (strain UAMH 1704) Uniprot NO.:C4JT27 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MASLLIIVFLSHVVTYLINTIGATTVDNLLWLLYLKLPNNTSRTAVEQRRLKGEVVQLKR EMKSTSSQDEFAKWAKLRRRHDKAMEEYEAKNKALGKHKGSFDLTVKSVRFFSTTGLKFF LQFWYSKTPMFELPRGWVPWQVEWVLSFPRAPLGTVSIQVWSGVCTTVVSLAGDALGVVI QSLILKMTKRGVARTSEGRPSQPMALKKEL Protein Names:Recommended name: Protein GET1 Alternative name(s): Guided entry of tail-anchored proteins 1 Gene Names:Name:GET1 ORF Names:UREG_05616 Expression Region:1-210 Sequence Info:fµLl length protein