ELISA Recombinant Tolumonas auensis UPF0761 membrane protein Tola_0461 (Tola_0461)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Tolumonas auensis (strain DSM 9187 / TA4) Uniprot NO.:C4L9W1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTQDPRRLLALRNQRWAKSRLFCLRSRRFSAFFWRRVWHDRLPVLAGHLAYVSLLSIVPL LAVVFSVLSWLPRFSYFRRQFELFMFSNFVPETEIAFRYHFSLFVKNASKTTSIGLLmLV LLALLLIAAIDENMNHIWRCRGQRKWLKTITMYSIVLGVVPLLVGGSLLLSSQIQGWALW HYELVSSLGGGLLELLPYLLSLGGILLLYKVVPNIYVRWQHALLGATLAALLFEVAKEGF GYYIAHFGTYKSIYGALAGIPILMIWLYMSWLVVLLGAEFTATLGEWQLNRTLRGRKPRL PG Protein Names:Recommended name: UPF0761 membrane protein Tola_0461 Gene Names:Ordered Locus Names:Tola_0461 Expression Region:1-302 Sequence Info:fµLl length protein