ELISA Recombinant Streptococcus pneumoniae Membrane protein insertase YidC(yidC)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Streptococcus pneumoniae (strain Taiwan19F-14) Uniprot NO.:C1CTN0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:CVNVDKTTGQPTGFIWNTIGAPMAEAIKYFATDKGLGFGVAIIIVTIIVRLIILPLGIYQ SWKATLHSEKMNALKHVLEPHQTRLKEATTQEEKLEAQQALFAAQKEHGISMFGGVGCFP ILLQMPFFSAIYFAAQHTEGVAQASYLGIPLGSPSMILVACAGVLYYLQSLLSLHGVEDE MQREQIKKMIYMSPLMIVVFSLFSPASVTLYWVVGGFMMILQQFIVNYIVRPKLRKKVRE ELAKNPPKASAFSKPSGRKDVTPEQPTAITSKKKHKNRNAGKQRSR Protein Names:Recommended name: Membrane protein insertase YidC Alternative name(s): Foldase YidC Membrane integrase YidC Membrane protein YidC Gene Names:Name:yidC Ordered Locus Names:SPT_1955 Expression Region:23-308 Sequence Info:fµLl length protein