ELISA Recombinant Sulfurihydrogenibium azorense NADH-quinone oxidoreductase subunit K(nuoK)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:SµLfurihydrogenibium azorense (strain Az-Fu1 / DSM 15241 / OCM 825) Uniprot NO.:C1DT39 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVPYEYYVALSGLLMVLGFIGVIVRKNIIAmLISTELmLNAVNVAFVAFDMKLHDVVGQV FVFFILTIAAAEAAIGLGLIMAIYRMKKDVDVEKLTELKG Protein Names:Recommended name: NADH-quinone oxidoreductase subunit K EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit K NDH-1 subunit K Gene Names:Name:nuoK Ordered Locus Names:SµLAZ_0281 Expression Region:1-100 Sequence Info:fµLl length protein