ELISA Recombinant Salmonella paratyphi C UPF0756 membrane protein YeaL(yeaL)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Salmonella paratyphi C (strain RKS4594) Uniprot NO.:C0Q711 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MFDVTLLILLGLAALGFISHNTTVAVSILVLIIVRVTPLNTFFPWIEKQGLTVGIIILTI GVMAPIASGTLPPSTLIHSFVNWKSLVAIAVGVFVSWLGGRGITLMGNQPQLVAGLLVGT VLGVALFRGVPVGPLIAAGLVSLIVGKQ Protein Names:Recommended name: UPF0756 membrane protein YeaL Gene Names:Name:yeaL Ordered Locus Names:SPC_2461 Expression Region:1-148 Sequence Info:fµLl length protein