ELISA Recombinant Teredinibacter turnerae Na(+)-translocating NADH-quinone reductase subunit E

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Teredinibacter turnerae (strain ATCC 39867 / T7901) Uniprot NO.:C5BII5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MADLIALFVRSVFIENMALAFFLGMCTFLAVSKKVDAAIGLGVAVVVVQTVTVPVNNLLY TYFLADGALAWAGLPNVDLSFLGLITYIGVIAALVQIMEMFLDRYVPALYNALGVFLPLI TVNCAIMGGSLFMVERDYNFAESVVFGTGSGFGWALAITALAGIREKMKYSDVPEGLQGL GITFIVVGLMSLGFMSFGGISL Protein Names:Recommended name: Na(+)-translocating NADH-quinone reductase subunit E Short name= Na(+)-NQR subunit E Short name= Na(+)-translocating NQR subunit E EC= 1.6.5.- Alternative name(s): NQR complex subunit E NQR-1 subunit E Gene Names:Name:nqrE Ordered Locus Names:TERTU_1953 Expression Region:1-202 Sequence Info:fµLl length protein