ELISA Recombinant Zygosaccharomyces rouxii Genetic interactor of prohibitin 7, mitochondrial(GEP7)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) (Candida mogii) Uniprot NO.:C5DT30 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:TQASSRLPPKSLLIKQADRIRRSKDGQADGSKLMVSSLKDIASMFQANAETPEDEEREIL NQQNYLRQQIESGELERLLQDKFNLDESISLMSTNLLVQQFPKLNAQQVELIQEAVSMDS NKHWNEIPQYMKQLQFYFAFGSHGPRLSIPFNSREKPLDFAFKIPSPVTTDGQTKIHKLK PSHLVNLHTITDQRSKIFQTTKLDPATRCILWSAILVSIVFGVQEWRLQQDPQAKITVLS NSV Protein Names:Recommended name: Genetic interactor of prohibitin 7, mitochondrial Gene Names:Name:GEP7 Ordered Locus Names:ZYRO0C04972g Expression Region:16-258 Sequence Info:fµLl length protein