ELISA Recombinant Zygosaccharomyces rouxii Altered inheritance of mitochondria protein 31, mitochondrial(AIM31)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) (Candida mogii) Uniprot NO.:C5DWC4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSGLPSSFDSKEASVDELPFLEKVKFHCKQQPLVPLGTLLTTGAVALAAQNVRTGNKKKA QVWFRWRVGLQAATLVALVAGSFIYGSSLKEKKSEEEKMREKAKMRELLWIQELERRDQE TQYRRKRAELARQKMQENEAAVSRLQKELKDLESHIKNEK Protein Names:Recommended name: Altered inheritance of mitochondria protein 31, mitochondrial Gene Names:Name:AIM31 Ordered Locus Names:ZYRO0D13684g Expression Region:1-160 Sequence Info:fµLl length protein