ELISA Recombinant Sorghum bicolor Casparian strip membrane protein Sb10g008220 (Sb10g008220)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Sorghum bicolor (Sorghum) (Sorghum vµLgare) Uniprot NO.:C5Z7E3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKGSSEHGETSKAAPLGRGGVSKGVSVLDLILRFIAIIGTLASAIAMGTTNETLPFFTQF IRFKAQYSDLPTLTFFVVANSIVCAYLILSLPLSIVHIIRSRAKYSRLLLIFLDAAmLAL VTAGASAAAAIVYLAHKGNVRANWLAICQQFDSFCERISGSLIGSFGAMVmLILLILLSA IALARR Protein Names:Recommended name: Casparian strip membrane protein Sb10g008220 Gene Names:Ordered Locus Names:Sb10g008220 Expression Region:1-186 Sequence Info:fµLl length protein