Skip to Content

ELISA Recombinant Saccharomyces cerevisiae Formation of crista junctions protein 1(FCJ1)

https://www.anagnostics.com/web/image/product.template/154314/image_1920?unique=e16ca1f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) (Baker's yeast) Uniprot NO.:C8ZCI0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:ASINTGTTVASKKASHKFRNTFWTIALSATAFYAGGIIYSQKNDKFGDFFSNNVPFAEDL LETYEHYHDRPTLFLEDSWDGLKAKSNDLLSGLTGSSQTRRSNRENIEVKKILSLEPLNI ETENSDPQLKEIIGSLNDLINSLNDSNLSIPESEFNSIKKSNQNmLTNLSQLNETLKEAL SNYMIQRTSEVITELNTQYENSKREFEKNLQKNLLQEVDEFKENLTKQKDKELEEKLKAN EELLQAKHANGVGLLSITQVKEFNKIIKDKIEKERNGRLAHLEEINSEVNDLSKSIDRSS KILSKNEALVQLTFQVDEIKSRINNNNLPDVNIDKELSRLKLLSNLLSTFNKKSCCDDGD CCSCKKGNKNEGKEGKISCKCKPKTNPPSLLSVALDELESTCSGKKILSNEQIYNRWNLL ADDFKTASLLPPNSGILGQLTAKVFSLFLFTKTGNPSNATDFDSVYARVGDNLRVSNLND AVEEVVSLKGWPHKVCESWIEDARRKLEVQRLVEILDCEIRTL Protein Names:Recommended name: Formation of crista junctions protein 1 Alternative name(s): Altered inheritance of mitochondria protein 28 Found in mitochondrial proteome protein 13 Mitofilin Gene Names:Name:FCJ1 Synonyms:AIM28, FMP13 ORF Names:EC1118_1K5_2740g Expression Region:17-539 Sequence Info:fµLl length protein

1,887.00 € 1887.0 EUR 1,887.00 €

1,887.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.