ELISA Recombinant Sorghum bicolor CASP-like protein Sb07g000300 (Sb07g000300)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Sorghum bicolor (Sorghum) (Sorghum vµLgare) Uniprot NO.:C5YLC9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTSESATVIQMDDGRAPAPAAAGAAAAAAASSSYATAPTSISAAEPAAAPRKTTTVPFLL RSGAEGFRRCLAVIDFLLRVAAFGPTLAAAISTGTADERLSVFTNFFQFHARFDDFPAFT FFLVANAVAAGYLVLSLPFSVVVILRPNKATGGVRLLLLLCDVLIMALLTAAGAAAAAIV YVAHSGNRRANWVPICMQFHGFCQRTSGSVVATFLAVLVFIVLILMAACVIRRSK Protein Names:Recommended name: CASP-like protein Sb07g000300 Gene Names:Ordered Locus Names:Sb07g000300 Expression Region:1-235 Sequence Info:fµLl length protein