ELISA Recombinant Verticillium albo-atrum High osmolarity signaling protein SHO1(SHO1)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Verticillium albo-atrum (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) (Verticillium wilt)
Uniprot NO.:C9SA05
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEHSRAQYGRRGMNMGNVIGDPFALASISIAmLAWVIAFISSIVAAVQTNDLPNLAWWIL ALEVGIVGAVFFVIASDTIQTYHVALTAYQTLALATLSILLNRIVYDGRGAMQAASAGYV LLSVVMALWMIYFGSAPSASPRAYVDSFALQKEGHGSRNTMTYGTGRPETSTSVQPPQMY TSAQLNGFENPSPVGGISQSQAPRNSAVPNLNSTGVTANGKPPGQDQEVGPPTEYPYRAK AIYSYEANPEDANEISFSKHEILEVSDVSGRWWQARKESGDTGIAPSNYLILL
Protein Names:Recommended name: High osmolarity signaling protein SHO1 Alternative name(s): Osmosensor SHO1
Gene Names:Name:SHO1 ORF Names:VDBG_02327
Expression Region:1-293
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.