ELISA Recombinant Xylanimonas cellulosilytica Sec-independent protein translocase protein TatC(tatC)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Xylanimonas cellµLosilytica (strain DSM 15894 / CECT 5975 / LMG 20990 / XIL07)
Uniprot NO.:D1BTU8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVSLTSVPPYADATPDTRASSGPAPGRRKRMPLREHLAELRTRLLLVAGGLVVGAVVGWL LYDPLLVLLTRPLHLAAATQHKDIALNFTALGSPLDTRIKVSLFLAVMVTCPWWLYQVWA FVTPGLTRREKRHAYGFLGAAVPLFLGGAGLSWWVLPHAVDIFASFVPAGSSQYVNAQEY LSFVMRLVLAFGVAFVAPVLLVALNLAGIVRHETLARGWRWAVLLAFVFAAVMTPTPDAL TMVLVAAPICALYFGALGVAVWHDRRADRRTAPAAA
Protein Names:Recommended name: Sec-independent protein translocase protein TatC
Gene Names:Name:tatC Ordered Locus Names:Xcel_0071
Expression Region:1-276
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.