Skip to Content

ELISA Recombinant Sordaria macrospora High osmolarity signaling protein SHO1(SHO1)

https://www.anagnostics.com/web/image/product.template/157642/image_1920?unique=263afdf
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) Uniprot NO.:D1ZRK4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MQSYGGSLNYSPSFNNPKMEHGRNSYRRKGIDMGNIIGDPFALATTSIATLAWIIILFGS IFGYRDQDPDKNLIWPTYSWFTLVFNFFLILGIFFVIASDSAQTYHVAIVGYLAVGLVGS TSSINNLIYSGVASMEATAAGYILLSMVTIIWIFYFGSAPSAVPRAYIDSFALSKESALP AHHMSRQTMNHNGLSSPNAYGSYNMRPETSASGLQPPQMYTGQLNGLENPARQSQIPQGF SSNNIPKPPQGTEGEIVPPTEYPYRAKAIFSYEANPDDANEISFSKHEVLEISDVSGRWW QARKETGETGIAPSNYLILL Protein Names:Recommended name: High osmolarity signaling protein SHO1 Alternative name(s): Osmosensor SHO1 Gene Names:Name:SHO1 ORF Names:SMAC_08497 Expression Region:1-320 Sequence Info:fµLl length protein

1,673.00 € 1673.0 EUR 1,673.00 €

1,673.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.