ELISA Recombinant Zygosaccharomyces rouxii Autophagy-related protein 33(ATG33)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) (Candida mogii)
Uniprot NO.:C5DRF7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSVCLGVTKGIAVSSLGIYAGILTTGTICTYMVPVDVITKHLNSVVCRVGEVASALGLLS TGFFSLSYFGAPSHLRHPYLIYSALVAPASALYLWAISRCNHKCHAKSKIAEQGKTNGDN KTQSPPLGDSVVDLGADSKVPSGHPPVKEGAKCPMGNAVVTNEPSSTDYARPAGCQSKFA KHLAVVTGVAIIGFLQSVIGVYGEPA
Protein Names:Recommended name: Autophagy-related protein 33
Gene Names:Name:ATG33 Ordered Locus Names:ZYRO0B08096g
Expression Region:1-206
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.