ELISA Recombinant Sorghum bicolor CASP-like protein Sb03g033320 (Sb03g033320)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Sorghum bicolor (Sorghum) (Sorghum vµLgare)
Uniprot NO.:C5XIF2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGSIGNGRSDSVVGIQMPPAGSKMVLEPEALQVTTSPVPRWPRLGVVMVATRAVAMVMAL LSMSLMVSSKQRGILTIFGIEIPLDANWSFSYSLQFLVAMSTASAAYSLAQLLLIAHKAV KKSPIVPSRRHAWLLFAGDQVFSLAMMSAGSAAAAVANLNRTGIRHTALPNFCKPLPRFC DLSAVSIACAFLSCVFLAASAVIDVIWLSSP
Protein Names:Recommended name: CASP-like protein Sb03g033320
Gene Names:Ordered Locus Names:Sb03g033320
Expression Region:1-211
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.