ELISA Recombinant Sorghum bicolor CASP-like protein Sb03g033320 (Sb03g033320)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Sorghum bicolor (Sorghum) (Sorghum vµLgare) Uniprot NO.:C5XIF2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGSIGNGRSDSVVGIQMPPAGSKMVLEPEALQVTTSPVPRWPRLGVVMVATRAVAMVMAL LSMSLMVSSKQRGILTIFGIEIPLDANWSFSYSLQFLVAMSTASAAYSLAQLLLIAHKAV KKSPIVPSRRHAWLLFAGDQVFSLAMMSAGSAAAAVANLNRTGIRHTALPNFCKPLPRFC DLSAVSIACAFLSCVFLAASAVIDVIWLSSP Protein Names:Recommended name: CASP-like protein Sb03g033320 Gene Names:Ordered Locus Names:Sb03g033320 Expression Region:1-211 Sequence Info:fµLl length protein