ELISA Recombinant Verticillium albo-atrum Signal peptidase complex catalytic subunit SEC11(SEC11)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Verticillium albo-atrum (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) (Verticillium wilt)
Uniprot NO.:C9S8G0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:mLSSLKNPRQAAAQLLNFGLILSTAFMMWKGLSVITDSPSPIVVVLSGSMEPAFQRGDLL FLWNRNLLRETDVGEVVVYNVKDKDIPIVHRIVRKFGAGASAKLLTKGDNNAADDTELYA RGQDYLERQDIIGSVVAYIPFVGYVTILLSEHPWLKTVmLGIMGLVVVLQRE
Protein Names:Recommended name: Signal peptidase complex catalytic subunit SEC11 EC= 3.4.21.89 Alternative name(s): Signal peptidase I
Gene Names:Name:SEC11 ORF Names:VDBG_01459
Expression Region:1-172
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.