ELISA Recombinant Verticillium albo-atrum Signal peptidase complex catalytic subunit SEC11(SEC11)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Verticillium albo-atrum (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) (Verticillium wilt) Uniprot NO.:C9S8G0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLSSLKNPRQAAAQLLNFGLILSTAFMMWKGLSVITDSPSPIVVVLSGSMEPAFQRGDLL FLWNRNLLRETDVGEVVVYNVKDKDIPIVHRIVRKFGAGASAKLLTKGDNNAADDTELYA RGQDYLERQDIIGSVVAYIPFVGYVTILLSEHPWLKTVmLGIMGLVVVLQRE Protein Names:Recommended name: Signal peptidase complex catalytic subunit SEC11 EC= 3.4.21.89 Alternative name(s): Signal peptidase I Gene Names:Name:SEC11 ORF Names:VDBG_01459 Expression Region:1-172 Sequence Info:fµLl length protein