ELISA Recombinant Salmonella typhimurium Secretion system apparatus lipoprotein SsaJ(ssaJ)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Salmonella typhimurium (strain 14028s / SGSC 2262) Uniprot NO.:D0ZWT5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:CDVDLYRSLPEDEANQmLALLMQHHIDAEKKQEEDGVTLRVEQSQFINAVELLRLNGYPH RQFTTADKMFPANQLVVSPQEEQQKINFLKEQRIEGmLSQMEGVINAKVTIALPTYDEGS NASPSSVAVFIKYSPQVNMEAFRVKIKDLIEMSIPGLQYSKISILMQPAEFRMVADVPAR QTFWIMDVINANKGKVVKWLMKYPYPLmLSLTGLLLGVGILIGYFCLRRRF Protein Names:Recommended name: Secretion system apparatus lipoprotein SsaJ Gene Names:Name:ssaJ Ordered Locus Names:STM14_1705 Expression Region:19-249 Sequence Info:fµLl length protein