ELISA Recombinant Verticillium albo-atrum Probable endonuclease LCL3(LCL3)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Verticillium albo-atrum (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) (Verticillium wilt) Uniprot NO.:C9SI22 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPWPFGPSGSSEAPPPQKPRDDKVEGREPAKSWNSLLPKPDPPLQAAKEWAPVFLTAVGS LAAFMFYQSYLRRFAGAASIQENFFRKRSLLGRVTSVGDGDGFHLYHTPGGKLAGWGWLR KIPEGRSNLKGETISIRLAGIDAPEGPHFGRPGQPFAAEAQAHLSKYILHRRVRAHLHKR DQYNRIVATVSTRQPFIKKDVGLEmLKQGLATTYEAKSGVEWGGKESIYKAAEAKAKAKK LGLWSIKASEFESPRDFKNRTQGNEKSERDVEGSTVQKPWWRRWLTG Protein Names:Recommended name: Probable endonuclease LCL3 EC= 3.1.-.- Gene Names:Name:LCL3 ORF Names:VDBG_04704 Expression Region:1-287 Sequence Info:fµLl length protein