ELISA Recombinant Schizophyllum commune Probable endonuclease LCL3(LCL3)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Schizophyllum commune (strain H4-8 / FGSC 9210) (Split gill fungus) Uniprot NO.:D8QGA7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPLIPWPASADDSSKGKDDEKDIATKAKELFALAGEIPPEYFSVAAFAAGSLSLAASYFV HKRYFRRIPNAEWVSPNHLARKRWIKGRVTSVGDNDNFRFYHTPGIGWRWPLKFRRVPTL TKELKDQTIHVRIAGVDAPENAHFGRPAQPYAQEALAYLRARILGKTVFCQLIRRDQYGR MVSHVRLAPRFLPATLFRGPNLAEDmLRKGWATTYEQHGAEYGEGGVERYKQIEQEAKDA RRGIWAKGVRGETPAEYKRRYAQAADGGEPPSKARAEKEQKRGWLQRLFSWK Protein Names:Recommended name: Probable endonuclease LCL3 EC= 3.1.-.- Gene Names:Name:LCL3 ORF Names:SCHCODRAFT_70433 Expression Region:1-292 Sequence Info:fµLl length protein