ELISA Recombinant Thermosediminibacter oceani Energy-coupling factor transporter transmembrane protein EcfT(ecfT)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Thermosediminibacter oceani (strain ATCC BAA-1034 / DSM 16646 / JW/IW-1228P) Uniprot NO.:D9RZP4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MREITIGQYIPGNSVIHRLDPRTKILITTAFMVLLFVIDDFTGYAFPAVFIIAVSILSGI SLKYMMRGLRPLVIIIVLTFVLNLFMIKGRVIYEIGPLDITYEGLYQGTFMVLRLImLIV GTSLLTLTTSPIALTDGIESLLKPFRRVGVPAHELAMMMTIALRFIPTLMEETDKIMKAQ MARGADFASGNVVQRARSLVPLLVPLFINAFRRADDLAMAMESRCYRGGENRTRMKQLRM TSADLAAFIATGLLAVGSIMSRFIW Protein Names:Recommended name: Energy-coupling factor transporter transmembrane protein EcfT Short name= ECF transporter T component EcfT Gene Names:Name:ecfT Ordered Locus Names:Toce_0151 Expression Region:1-265 Sequence Info:fµLl length protein