ELISA Recombinant Thellungiella halophila CASP-like protein 1

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Thellungiella halophila (Salt cress) Uniprot NO.:E4MWF4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSYLGVGLSPVNVAGTKMKLMDRKVRLTELILRCSVCALALVAAILIATDTQVKEIFTIQ KKAKYTDMKALVFLVVVNGIAAAYSLLHMVRCVVGMMKGSVLFSKPLAWAIFSGDQAIAY LTVAGVAAAAQSAAFAKLGEPELQWMKICTIYGKFCNQVGEGIATALLASIGMVLISSIS AFALFRLYGGNKAQQGSRW Protein Names:Recommended name: CASP-like protein 1 Gene Names: Expression Region:1-199 Sequence Info:fµLl length protein