ELISA Recombinant Schizosaccharomyces pombe Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit ost5(ost5)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:G2TRU0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSLNELIVAALKLFFYNKEQKSDCIFFCQVQIVIQISSSMFSLVIRRIHIRKLWYITVFT INASMFSGFFNNPSLLTPNENLLFQVGLHYSFAV Protein Names:Recommended name: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit ost5 Short name= Oligosaccharyl transferase subunit ost5 EC= 2.4.1.119 Alternative name(s): Oligosaccharyl transferase subunit zeta Gene Names:Name:ost5 ORF Names:SPCC18.19c Expression Region:1-94 Sequence Info:fµLl length protein