ELISA Recombinant Saccharomyces cerevisiae Uncharacterized membrane protein YAL064W-B (YAL064W-B)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:O13512 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAGEAVSEHTPDSQEVTVTSVVCCLDSVVEIGHHVVYSVVTPLIVAVLIDTMAGEAVLEH TSDSQEEIVTTVVCSVVPLVCFVVSVVCFVISVVEIGHHVVYSVVAPLTVTVAVETIAEE MDSVHT Protein Names:Recommended name: Uncharacterized membrane protein YAL064W-B Gene Names:Ordered Locus Names:YAL064W-B Expression Region:1-126 Sequence Info:fµLl length protein