ELISA Recombinant Saccharomyces cerevisiae Putative uncharacterized protein VPS69(VPS69)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:O13584 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MHTYIYIYTVYIQMVAFSPYRIVLPFVAFVDLASFSSFRSYQAFLRPFLRPFRHQTCSSY FALDLDFASAFVVPAASFVESLLAYQAYSAYQACLAYPACLACQAS Protein Names:Recommended name: Putative uncharacterized protein VPS69 Gene Names:Name:VPS69 Ordered Locus Names:YPR087W Expression Region:1-106 Sequence Info:fµLl length protein