ELISA Recombinant Schizosaccharomyces pombe Probable C-5 sterol desaturase 2 (pi075, SPBC27B12.03c)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:O13666 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDVVLQYADKYVFDTFYGKIAESFDSSSSFANTAVNSTTLGLAEKVNFAITSGLLDRNNV WRQFTSLFLITWIMGTLSYFLSASFAYYVYFDREEARRHPKFLKNQEHLELMVALKNLPG MAILTAPWFLAEIRGYGYVYDKLDEYGYFYLFFSIALFLLFSDFLIYWIHRALHHRWLYA PLHKLHHKWIVPTPYSSHAFHYLDGYSQSLPYHMFPFFFPLNKYVYLLLFGSVNYWTVLI HDGKYFSNNAVVNGAAHHAAHHMYFNYNYGQFFTLFDRLCSSYRQPDQELFDAELRNEKL QEQRIRFMETVQYTVEGKDDRTYASKKDN Protein Names:Recommended name: Probable C-5 sterol desaturase 2 EC= 1.3.3.- Alternative name(s): Ergosterol Delta(5,6) desaturase 2 Sterol-C5-desaturase 2 Gene Names:ORF Names:pi075, SPBC27B12.03c Expression Region:1-329 Sequence Info:fµLl length protein