ELISA Recombinant Schizosaccharomyces pombe Probable V-type proton ATPase 20 kDa proteolipid subunit(vma16)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Uniprot NO.:O14046
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSLFSTSLWTTTVMSIIVGLYmLFHNSGESFDFGSFLLDTSPYTWGLLGIASCVAFGIIG AAWGIFICGTSILGGAVKAPRIKTKNLISIIFCEVVAIYSLIIAIVFSAKINDINPAGFY TKSHYYTGFALFWGGITVGLCNLICGVCVGITGSSAALADAQDASLFVKVLVVEIFGSVL GLFGLIVGLLIGGKASDFS
Protein Names:Recommended name: Probable V-type proton ATPase 20 kDa proteolipid subunit Short name= V-ATPase 20 kDa proteolipid subunit Alternative name(s): Vacuolar proton pump 20 kDa proteolipid subunit
Gene Names:Name:vma16 ORF Names:SPAC2C4.13
Expression Region:1-199
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.