ELISA Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1161 (AF_1161)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Archaeoglobus fµLgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) Uniprot NO.:O29105 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPGEELVRRFLERRVLTEKNIERFVKYYWLVSTARMVLGVTILILILIGGLKFSQLIPWR Protein Names:Recommended name: Uncharacterized protein AF_1161 Gene Names:Ordered Locus Names:AF_1161 Expression Region:1-60 Sequence Info:fµLl length protein