ELISA Recombinant Rhodobacter capsulatus Energy-coupling factor transporter transmembrane protein BioN(bioN)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rhodobacter capsµLatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) Uniprot NO.:D5ARG9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLSLALPCRSWAHRLPAALKFGLLAVAMIALMRIGSLAGQGAAVLVVAALTASLGRKAIR QSLVTLRPLVWIVAVILIWDSLQGAVAQGVLFGLRVLAMVGLANAVTLTTPLPEIVALIE RLAQPLARFGISPRIPAISVALVIRFVPVLRARHDTLAEAWRARSARKPRGKLLAPLTFS LLDDADHMADALRARGGLALPRKGRDTVGT Protein Names:Recommended name: Energy-coupling factor transporter transmembrane protein BioN Short name= ECF transporter T component BioN Gene Names:Name:bioN Synonyms:cbiQ3, ecfT Ordered Locus Names:RCAP_rcc03250 Expression Region:1-210 Sequence Info:fµLl length protein